PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G259800.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family GRF
Protein Properties Length: 456aa    MW: 49716.5 Da    PI: 7.378
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G259800.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.61.2e-2479123145
                WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                        d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Aqcoe6G259800.2.p  79 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEG 123
                        79****************************************985 PP

2QLQ63.17.4e-221046137
                QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                       ++FT++Q+++L++Q+l+yKy++an+PvP++Ll +i+k
  Aqcoe6G259800.2.p 10 GPFTPSQWMELEHQALIYKYINANVPVPSNLLIPISK 46
                       59********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.8E-131046IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.6E-161144IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.391146IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.66379123IPR014977WRC domain
PfamPF088795.0E-2180122IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MHGGLTGARG PFTPSQWMEL EHQALIYKYI NANVPVPSNL LIPISKAFNP SAFSAFSGSF  60
RPNTLGWGSF HLGFSGNNDP EPGRCRRTDG KKWRCSRDAV ADQKYCERHM NRGRHRSRKP  120
VEGQTGHAAA GPAATKVMAM CSGGGASNSL PVTQHKVDSV QSNAADCSSH THMNRKLPNN  180
RSLGGRLQDS QGLSVLSPAV NMTCKDTPFS NLKQHIPCEE ATRQEFGFFS SVSLLNTSQR  240
SSYIDCENFG STPDLNSQES RVHDPLRHFI DDCPKNQSDR SRIAWPEVEE TQLDRTQLSI  300
SIPMTSDFLS SLPTHDKLAL SPLRLSREFD PVQMGLGVGS FPNEPTHRQV NWIPVAWESS  360
MGGPLGEVLN HTNNASGDQK STLSALNLMT EGWDGGLQME LSPTGVLQKT SFGSLSNSST  420
GSSPRAETNQ TLEEKSFCDN FLNPTIVNSS TLLPL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010273550.10.0PREDICTED: growth-regulating factor 6-like isoform X2
TrEMBLF6H1750.0F6H175_VITVI; Putative uncharacterized protein
STRINGVIT_18s0001g08650.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.14e-96growth-regulating factor 1